Lineage for d3oxoa2 (3oxo A:262-478)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922432Family c.124.1.3: CoA transferase beta subunit-like [74657] (4 proteins)
    catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest
  6. 2922484Protein automated matches [227046] (1 species)
    not a true protein
  7. 2922485Species Pig (Sus scrofa) [TaxId:9823] [226017] (1 PDB entry)
  8. 2922486Domain d3oxoa2: 3oxo A:262-478 [214580]
    Other proteins in same PDB: d3oxoa1, d3oxoa3, d3oxob1, d3oxob3, d3oxoc1, d3oxoc3, d3oxod1, d3oxod3, d3oxoe1, d3oxoe3, d3oxof1, d3oxof3, d3oxog1, d3oxog3, d3oxoh1, d3oxoh3
    automated match to d1ooyb1
    complexed with cl, coa

Details for d3oxoa2

PDB Entry: 3oxo (more details), 2.3 Å

PDB Description: Succinyl-CoA:3-ketoacid CoA transferase from pig heart covalently bound to CoA
PDB Compounds: (A:) Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial

SCOPe Domain Sequences for d3oxoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oxoa2 c.124.1.3 (A:262-478) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
vreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnevd
adlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgklv
kgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvdr
kkgltlielwegltvddikkstgcdfavspklipmqq

SCOPe Domain Coordinates for d3oxoa2:

Click to download the PDB-style file with coordinates for d3oxoa2.
(The format of our PDB-style files is described here.)

Timeline for d3oxoa2: