Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (60 species) not a true protein |
Species Curcuma longa [TaxId:136217] [226034] (2 PDB entries) |
Domain d3ov3d2: 3ov3 D:236-389 [214571] Other proteins in same PDB: d3ov3a3, d3ov3b3, d3ov3c3, d3ov3d3 automated match to d1bi5a2 complexed with mli; mutant |
PDB Entry: 3ov3 (more details), 2.5 Å
SCOPe Domain Sequences for d3ov3d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ov3d2 c.95.1.0 (D:236-389) automated matches {Curcuma longa [TaxId: 136217]} iyeiaaamqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrew ndvfwvahpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsav egrsttgdglqwgvllgfgpglsietvvlrsmpl
Timeline for d3ov3d2: