Lineage for d3ov3a1 (3ov3 A:5-235)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2164457Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2164458Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2165221Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2165222Protein automated matches [196909] (60 species)
    not a true protein
  7. 2165394Species Curcuma longa [TaxId:136217] [226034] (2 PDB entries)
  8. 2165403Domain d3ov3a1: 3ov3 A:5-235 [214564]
    Other proteins in same PDB: d3ov3a3, d3ov3b3, d3ov3c3, d3ov3d3
    automated match to d1cmla1
    complexed with mli; mutant

Details for d3ov3a1

PDB Entry: 3ov3 (more details), 2.5 Å

PDB Description: G211F mutant of curcumin synthase 1 from Curcuma longa
PDB Compounds: (A:) Curcumin synthase

SCOPe Domain Sequences for d3ov3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ov3a1 c.95.1.0 (A:5-235) automated matches {Curcuma longa [TaxId: 136217]}
halrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmcektm
vkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrpksei
thlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaennrga
rvlvvaceitvlsfrgpnegdfealafqagfgdgagavvvgadplegiekp

SCOPe Domain Coordinates for d3ov3a1:

Click to download the PDB-style file with coordinates for d3ov3a1.
(The format of our PDB-style files is described here.)

Timeline for d3ov3a1: