SCOP 1.73: Domain d1egjl2: 1egj L:108-211

Lineage for d1egjl2 (1egj L:108-211)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)

8. Domain d1egjl2: 1egj L:108-211 [21456]
   Other proteins in same PDB: d1egja_, d1egjh1, d1egjh2, d1egjl1
   part of Fab 13B5 against cytokine receptor common beta chain domain 4
   complexed with nag

Details for d1egjl2

PDB Entry: 1egj, 2.8 Å

PDB Description: domain 4 of the beta common chain in complex with an antibody

PDB Compounds: (L:) antibody (light chain)

SCOP Domain Sequences for d1egjl2:

Sequence; same for both SEQRES and ATOM records:

>d1egjl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
rgdaaptvsifppsseqltsggasvvcflnnfypkdanvawkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1egjl2:

• d1egjl2 first appeared (with stable ids) in SCOP 1.55
  
• d1egjl2 appears in SCOP 1.71
  
• d1egjl2 appears in SCOP 1.75
  
• d1egjl2 appears in the current release, SCOPe 2.08