SCOP 1.55: Domain d1egjl2: 1egj L:108-211

Lineage for d1egjl2 (1egj L:108-211)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain [49112] (1 PDB entry)

8. Domain d1egjl2: 1egj L:108-211 [21456]
   Other proteins in same PDB: d1egja_, d1egjh1, d1egjl1

Details for d1egjl2

PDB Entry: 1egj, 2.8 Å

PDB Description: domain 4 of the beta common chain in complex with an antibody

SCOP Domain Sequences for d1egjl2:

Sequence; same for both SEQRES and ATOM records:

>d1egjl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab against cytokyne receptor common beta chain domain 4, (mouse), kappa L chain}
rgdaaptvsifppsseqltsggasvvcflnnfypkdanvawkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1egjl2:

• d1egjl2 appears in SCOP 1.57
  
• d1egjl2 appears in the current release, SCOPe 2.08