Lineage for d3otrf1 (3otr F:1-145)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905910Species Toxoplasma gondii [TaxId:508771] [225974] (1 PDB entry)
  8. 1905916Domain d3otrf1: 3otr F:1-145 [214551]
    Other proteins in same PDB: d3otra2, d3otrb2, d3otrc2, d3otrd2, d3otre2, d3otrf2
    automated match to d1pdza2
    complexed with cl, so4

Details for d3otrf1

PDB Entry: 3otr (more details), 2.75 Å

PDB Description: 2.75 angstrom crystal structure of enolase 1 from toxoplasma gondii
PDB Compounds: (F:) enolase

SCOPe Domain Sequences for d3otrf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3otrf1 d.54.1.0 (F:1-145) automated matches {Toxoplasma gondii [TaxId: 508771]}
mvvikdivareildsrgnptievdvsteggvfraavpsgastgiyealelrdkdpkrylg
kgvlnaveivrqeikpallgkdpcdqkgidmlmveqldgtknewgysksklganailgvs
iaccragaaskglplykyiatlagk

SCOPe Domain Coordinates for d3otrf1:

Click to download the PDB-style file with coordinates for d3otrf1.
(The format of our PDB-style files is described here.)

Timeline for d3otrf1: