Lineage for d1e6jl2 (1e6j L:106-210)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221183Species Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain [49111] (2 PDB entries)
  8. 221187Domain d1e6jl2: 1e6j L:106-210 [21454]
    Other proteins in same PDB: d1e6jh1, d1e6jl1, d1e6jp1, d1e6jp2

Details for d1e6jl2

PDB Entry: 1e6j (more details), 3 Å

PDB Description: crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5

SCOP Domain Sequences for d1e6jl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6jl2 b.1.1.2 (L:106-210) Immunoglobulin (constant domains of L and H chains) {Fab 13B5 against HIV-1 capsid protein p24, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d1e6jl2:

Click to download the PDB-style file with coordinates for d1e6jl2.
(The format of our PDB-style files is described here.)

Timeline for d1e6jl2: