Lineage for d3ot5c_ (3ot5 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142080Family c.87.1.3: UDP-N-acetylglucosamine 2-epimerase [53763] (2 protein domains)
    automatically mapped to Pfam PF02350
  6. 2142097Protein automated matches [197010] (3 species)
    not a true protein
  7. 2142101Species Listeria monocytogenes [TaxId:169963] [225976] (1 PDB entry)
  8. 2142104Domain d3ot5c_: 3ot5 C: [214531]
    automated match to d1o6ca_
    complexed with peg, pge

Details for d3ot5c_

PDB Entry: 3ot5 (more details), 2.2 Å

PDB Description: 2.2 angstrom resolution crystal structure of putative udp-n- acetylglucosamine 2-epimerase from listeria monocytogenes
PDB Compounds: (C:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d3ot5c_:

Sequence, based on SEQRES records: (download)

>d3ot5c_ c.87.1.3 (C:) automated matches {Listeria monocytogenes [TaxId: 169963]}
makikvmsifgtrpeaikmaplvlalekepetfestvvitaqhremldqvleifdikpdi
dldimkkgqtlaeitsrvmngineviaaenpdivlvhgdtttsfaaglatfyqqkmlghv
eaglrtwnkyspfpeemnrqltgvmadihfsptkqakenllaegkdpatifvtgntaida
lkttvqkdyhhpilenlgdnrlilmtahrrenlgepmqgmfeavreivesredtelvypm
hlnpavrekamailggherihliepldaidfhnflrksylvftdsggvqeeapgmgvpvl
vlrdtterpegieagtlkligtnkenlikealdlldnkeshdkmaqaanpygdgfaanri
laaikshfeetdrpedfiv

Sequence, based on observed residues (ATOM records): (download)

>d3ot5c_ c.87.1.3 (C:) automated matches {Listeria monocytogenes [TaxId: 169963]}
makikvmsifgtrpeaikmaplvlalekepetfestvvitaqhremldqvleifdikpdi
dldimqtlaeitsrvmngineviaaenpdivlvhgdtttsfaaglatfyqqkmlghveag
lrtwnkyspfpeemnrqltgvmadihfsptkqakenllaegkdpatifvtgntaidalkt
tvqkdyhhpilenlgdnrlilmtahrrenlgepmqgmfeavreivesredtelvypmhln
pavrekamailggherihliepldaidfhnflrksylvftdsggvqeeapgmgvpvlvlr
dtterpegieagtlkligtnkenlikealdlldnkeshdkmaqaanpygdgfaanrilaa
ikshfeetdrpedfiv

SCOPe Domain Coordinates for d3ot5c_:

Click to download the PDB-style file with coordinates for d3ot5c_.
(The format of our PDB-style files is described here.)

Timeline for d3ot5c_: