Lineage for d3os5a1 (3os5 A:116-193)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813016Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2813072Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 2813073Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 2813074Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 2813075Species Human (Homo sapiens) [TaxId:9606] [82188] (19 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 2813083Domain d3os5a1: 3os5 A:116-193 [214522]
    Other proteins in same PDB: d3os5a2
    automated match to d1n6ca1
    complexed with bme, edo, sah, unl

    fragment; missing more than one-third of the common structure and/or sequence

Details for d3os5a1

PDB Entry: 3os5 (more details), 1.69 Å

PDB Description: SET7/9-Dnmt1 K142me1 complex
PDB Compounds: (A:) Histone-lysine N-methyltransferase SETD7

SCOPe Domain Sequences for d3os5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3os5a1 b.76.2.1 (A:116-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
eegrphfelmpgnsvyhf

SCOPe Domain Coordinates for d3os5a1:

Click to download the PDB-style file with coordinates for d3os5a1.
(The format of our PDB-style files is described here.)

Timeline for d3os5a1: