Lineage for d1e6ol2 (1e6o L:106-210)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656160Domain d1e6ol2: 1e6o L:106-210 [21452]
    Other proteins in same PDB: d1e6oh1, d1e6oh2, d1e6ol1
    part of Fab 13B5 against HIV-1 capsid protein p24

Details for d1e6ol2

PDB Entry: 1e6o (more details), 1.8 Å

PDB Description: crystal structure of fab13b5 against hiv-1 capsid protein p24
PDB Compounds: (L:) immunoglobulin light chain

SCOP Domain Sequences for d1e6ol2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6ol2 b.1.1.2 (L:106-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d1e6ol2:

Click to download the PDB-style file with coordinates for d1e6ol2.
(The format of our PDB-style files is described here.)

Timeline for d1e6ol2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e6ol1