SCOPe 2.08: Domain d3os4a2: 3os4 A:141-395

Lineage for d3os4a2 (3os4 A:141-395)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.0: automated matches [227169] (1 protein)
   not a true family

6. Protein automated matches [226879] (8 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [225973] (1 PDB entry)

8. Domain d3os4a2: 3os4 A:141-395 [214519]
   Other proteins in same PDB: d3os4a1, d3os4b1
   automated match to d1yira1
   complexed with acy, cl, fmt, gol, mg, peg

Details for d3os4a2

PDB Entry: 3os4, 1.6 Å

PDB Description: the crystal structure of nicotinate phosphoribosyltransferase from yersinia pestis

PDB Compounds: (A:) Nicotinate phosphoribosyltransferase

SCOPe Domain Sequences for d3os4a2:

Sequence; same for both SEQRES and ATOM records:

>d3os4a2 c.1.17.0 (A:141-395) automated matches {Yersinia pestis [TaxId: 214092]}
vttdqavqqlrtkleqfnalsadidithfklmdfgtrrrfsreiqhtvvstlkdefpylv
gtsnydlartlalapvgtqahewfqahqqisptlansqrvalqvwldeypnqlgialtdc
itmdaflrdfdlafanryqglrhdsgdpiewgekaiahyeklgidpmkkvlvfsdnldle
kalflyrhfyqriklvfgigtrltcdipdvkplniviklvecndkpvaklsdspgkticq
dpafvdqlrkafalp

Timeline for d3os4a2:

• d3os4a2 first appeared in SCOPe 2.03
  
• d3os4a2 appears in SCOPe 2.07