Lineage for d3os4a2 (3os4 A:141-395)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839614Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2839839Family c.1.17.0: automated matches [227169] (1 protein)
    not a true family
  6. 2839840Protein automated matches [226879] (8 species)
    not a true protein
  7. 2839877Species Yersinia pestis [TaxId:214092] [225973] (1 PDB entry)
  8. 2839878Domain d3os4a2: 3os4 A:141-395 [214519]
    Other proteins in same PDB: d3os4a1, d3os4b1
    automated match to d1yira1
    complexed with acy, cl, fmt, gol, mg, peg

Details for d3os4a2

PDB Entry: 3os4 (more details), 1.6 Å

PDB Description: the crystal structure of nicotinate phosphoribosyltransferase from yersinia pestis
PDB Compounds: (A:) Nicotinate phosphoribosyltransferase

SCOPe Domain Sequences for d3os4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3os4a2 c.1.17.0 (A:141-395) automated matches {Yersinia pestis [TaxId: 214092]}
vttdqavqqlrtkleqfnalsadidithfklmdfgtrrrfsreiqhtvvstlkdefpylv
gtsnydlartlalapvgtqahewfqahqqisptlansqrvalqvwldeypnqlgialtdc
itmdaflrdfdlafanryqglrhdsgdpiewgekaiahyeklgidpmkkvlvfsdnldle
kalflyrhfyqriklvfgigtrltcdipdvkplniviklvecndkpvaklsdspgkticq
dpafvdqlrkafalp

SCOPe Domain Coordinates for d3os4a2:

Click to download the PDB-style file with coordinates for d3os4a2.
(The format of our PDB-style files is described here.)

Timeline for d3os4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3os4a1