Lineage for d3orya2 (3ory A:225-339)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329325Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 2329373Family a.60.7.0: automated matches [227268] (1 protein)
    not a true family
  6. 2329374Protein automated matches [227061] (2 species)
    not a true protein
  7. 2329375Species Desulfurococcus amylolyticus [TaxId:94694] [226072] (1 PDB entry)
  8. 2329376Domain d3orya2: 3ory A:225-339 [214513]
    Other proteins in same PDB: d3orya1
    automated match to d1b43a1
    complexed with po4

Details for d3orya2

PDB Entry: 3ory (more details), 2 Å

PDB Description: Crystal structure of Flap endonuclease 1 from hyperthermophilic archaeon Desulfurococcus amylolyticus
PDB Compounds: (A:) flap endonuclease 1

SCOPe Domain Sequences for d3orya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3orya2 a.60.7.0 (A:225-339) automated matches {Desulfurococcus amylolyticus [TaxId: 94694]}
itlenlidigillgtdynpdgfegigpkkalqlvkayggiekipkpilkspievdviaik
kyflqpqvtdnyriewhtpdpdavkrilvdehdfsidrvstaleryvkafkenir

SCOPe Domain Coordinates for d3orya2:

Click to download the PDB-style file with coordinates for d3orya2.
(The format of our PDB-style files is described here.)

Timeline for d3orya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3orya1