SCOPe 2.06: Domain d3orya2: 3ory A:225-339

Lineage for d3orya2 (3ory A:225-339)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families)

5. Family a.60.7.0: automated matches [227268] (1 protein)
   not a true family

6. Protein automated matches [227061] (2 species)
   not a true protein

7. Species Desulfurococcus amylolyticus [TaxId:94694] [226072] (1 PDB entry)

8. Domain d3orya2: 3ory A:225-339 [214513]
   Other proteins in same PDB: d3orya1
   automated match to d1b43a1
   complexed with po4

Details for d3orya2

PDB Entry: 3ory, 2 Å

PDB Description: Crystal structure of Flap endonuclease 1 from hyperthermophilic archaeon Desulfurococcus amylolyticus

PDB Compounds: (A:) flap endonuclease 1

SCOPe Domain Sequences for d3orya2:

Sequence; same for both SEQRES and ATOM records:

>d3orya2 a.60.7.0 (A:225-339) automated matches {Desulfurococcus amylolyticus [TaxId: 94694]}
itlenlidigillgtdynpdgfegigpkkalqlvkayggiekipkpilkspievdviaik
kyflqpqvtdnyriewhtpdpdavkrilvdehdfsidrvstaleryvkafkenir

Timeline for d3orya2:

• d3orya2 first appeared in SCOPe 2.03
  
• d3orya2 appears in SCOPe 2.05
  
• d3orya2 appears in SCOPe 2.07
  
• d3orya2 appears in the current release, SCOPe 2.08