Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) |
Family a.60.7.0: automated matches [227268] (1 protein) not a true family |
Protein automated matches [227061] (2 species) not a true protein |
Species Desulfurococcus amylolyticus [TaxId:94694] [226072] (1 PDB entry) |
Domain d3orya2: 3ory A:225-339 [214513] Other proteins in same PDB: d3orya1 automated match to d1b43a1 complexed with po4 |
PDB Entry: 3ory (more details), 2 Å
SCOPe Domain Sequences for d3orya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3orya2 a.60.7.0 (A:225-339) automated matches {Desulfurococcus amylolyticus [TaxId: 94694]} itlenlidigillgtdynpdgfegigpkkalqlvkayggiekipkpilkspievdviaik kyflqpqvtdnyriewhtpdpdavkrilvdehdfsidrvstaleryvkafkenir
Timeline for d3orya2: