SCOPe 2.08: Domain d3orya1: 3ory A:-3-224

Lineage for d3orya1 (3ory A:-3-224)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (4 families)

5. Family c.120.1.0: automated matches [227267] (1 protein)
   not a true family

6. Protein automated matches [227060] (2 species)
   not a true protein

7. Species Desulfurococcus amylolyticus [TaxId:94694] [226071] (1 PDB entry)

8. Domain d3orya1: 3ory A:-3-224 [214512]
   Other proteins in same PDB: d3orya2
   automated match to d1b43a2
   complexed with po4

Details for d3orya1

PDB Entry: 3ory, 2 Å

PDB Description: Crystal structure of Flap endonuclease 1 from hyperthermophilic archaeon Desulfurococcus amylolyticus

PDB Compounds: (A:) flap endonuclease 1

SCOPe Domain Sequences for d3orya1:

Sequence; same for both SEQRES and ATOM records:

>d3orya1 c.120.1.0 (A:-3-224) automated matches {Desulfurococcus amylolyticus [TaxId: 94694]}
gvdmgvdlkdiipgeaktviedlrilhgkiividgynalyqflaairqpdgtplmdnngr
itshlsglfyrtiniveagikpvyvfdgkppelkareierrkavkeeaakkyeeavqsgd
lelarryammsaklteemvrdakslldamgipwvqapaegeaqaayivkkgdayasasqd
ydsllfgspklvrnltisgrrklprkneyvevkpelieldkllvqlg

Timeline for d3orya1:

• d3orya1 first appeared in SCOPe 2.03
  
• d3orya1 appears in SCOPe 2.07