![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.120.1: PIN domain-like [88723] (4 families) ![]() |
![]() | Family c.120.1.0: automated matches [227267] (1 protein) not a true family |
![]() | Protein automated matches [227060] (2 species) not a true protein |
![]() | Species Desulfurococcus amylolyticus [TaxId:94694] [226071] (1 PDB entry) |
![]() | Domain d3orya1: 3ory A:-3-224 [214512] Other proteins in same PDB: d3orya2 automated match to d1b43a2 complexed with po4 |
PDB Entry: 3ory (more details), 2 Å
SCOPe Domain Sequences for d3orya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3orya1 c.120.1.0 (A:-3-224) automated matches {Desulfurococcus amylolyticus [TaxId: 94694]} gvdmgvdlkdiipgeaktviedlrilhgkiividgynalyqflaairqpdgtplmdnngr itshlsglfyrtiniveagikpvyvfdgkppelkareierrkavkeeaakkyeeavqsgd lelarryammsaklteemvrdakslldamgipwvqapaegeaqaayivkkgdayasasqd ydsllfgspklvrnltisgrrklprkneyvevkpelieldkllvqlg
Timeline for d3orya1: