Lineage for d3orya1 (3ory A:-3-224)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921858Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2921859Superfamily c.120.1: PIN domain-like [88723] (4 families) (S)
  5. 2921978Family c.120.1.0: automated matches [227267] (1 protein)
    not a true family
  6. 2921979Protein automated matches [227060] (2 species)
    not a true protein
  7. 2921980Species Desulfurococcus amylolyticus [TaxId:94694] [226071] (1 PDB entry)
  8. 2921981Domain d3orya1: 3ory A:-3-224 [214512]
    Other proteins in same PDB: d3orya2
    automated match to d1b43a2
    complexed with po4

Details for d3orya1

PDB Entry: 3ory (more details), 2 Å

PDB Description: Crystal structure of Flap endonuclease 1 from hyperthermophilic archaeon Desulfurococcus amylolyticus
PDB Compounds: (A:) flap endonuclease 1

SCOPe Domain Sequences for d3orya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3orya1 c.120.1.0 (A:-3-224) automated matches {Desulfurococcus amylolyticus [TaxId: 94694]}
gvdmgvdlkdiipgeaktviedlrilhgkiividgynalyqflaairqpdgtplmdnngr
itshlsglfyrtiniveagikpvyvfdgkppelkareierrkavkeeaakkyeeavqsgd
lelarryammsaklteemvrdakslldamgipwvqapaegeaqaayivkkgdayasasqd
ydsllfgspklvrnltisgrrklprkneyvevkpelieldkllvqlg

SCOPe Domain Coordinates for d3orya1:

Click to download the PDB-style file with coordinates for d3orya1.
(The format of our PDB-style files is described here.)

Timeline for d3orya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3orya2