SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1fl3b2 (1fl3 B:114-215)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2023413Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2023645Species Mouse (Mus musculus) [TaxId:10090] [88567] (355 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2023876Domain d1fl3b2: 1fl3 B:114-215 [21451]
    Other proteins in same PDB: d1fl3a1, d1fl3a2, d1fl3b1, d1fl3h1, d1fl3h2, d1fl3l1
    part of blue fluorescent Fab 19G2
    complexed with spb

Details for d1fl3b2

PDB Entry: 1fl3 (more details), 2.45 Å

PDB Description: crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k
PDB Compounds: (B:) blue fluorescent antibody (19g2)-light chain

SCOPe Domain Sequences for d1fl3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl3b2 b.1.1.2 (B:114-215) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhngytceathktstspivksfn

SCOPe Domain Coordinates for d1fl3b2:

Click to download the PDB-style file with coordinates for d1fl3b2.
(The format of our PDB-style files is described here.)

Timeline for d1fl3b2: