Lineage for d3orsg1 (3ors G:1-160)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857183Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2857299Family c.23.8.0: automated matches [191522] (1 protein)
    not a true family
  6. 2857300Protein automated matches [190879] (8 species)
    not a true protein
  7. 2857351Species Staphylococcus aureus [TaxId:426430] [226174] (1 PDB entry)
  8. 2857358Domain d3orsg1: 3ors G:1-160 [214501]
    Other proteins in same PDB: d3orsa2, d3orsb2, d3orsc2, d3orsd2, d3orse2, d3orsf2, d3orsg2, d3orsh2
    automated match to d3lp6b_
    complexed with so4

Details for d3orsg1

PDB Entry: 3ors (more details), 1.45 Å

PDB Description: Crystal Structure of N5-Carboxyaminoimidazole Ribonucleotide Mutase from Staphylococcus aureus
PDB Compounds: (G:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d3orsg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3orsg1 c.23.8.0 (G:1-160) automated matches {Staphylococcus aureus [TaxId: 426430]}
mkvavimgsssdwkimqescnmldyfeipyekqvvsahrtpkmmvqfasearerginiii
agaggaahlpgmvaslttlpvigvpietkslkgidsllsivqmpggipvattaigaagak
nagilaarmlsiqnpslveklnqyessliqkvedmqnelq

SCOPe Domain Coordinates for d3orsg1:

Click to download the PDB-style file with coordinates for d3orsg1.
(The format of our PDB-style files is described here.)

Timeline for d3orsg1: