Lineage for d3orsf_ (3ors F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1839075Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 1839149Family c.23.8.0: automated matches [191522] (1 protein)
    not a true family
  6. 1839150Protein automated matches [190879] (7 species)
    not a true protein
  7. 1839201Species Staphylococcus aureus [TaxId:426430] [226174] (1 PDB entry)
  8. 1839207Domain d3orsf_: 3ors F: [214500]
    automated match to d3lp6b_
    complexed with so4

Details for d3orsf_

PDB Entry: 3ors (more details), 1.45 Å

PDB Description: Crystal Structure of N5-Carboxyaminoimidazole Ribonucleotide Mutase from Staphylococcus aureus
PDB Compounds: (F:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d3orsf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3orsf_ c.23.8.0 (F:) automated matches {Staphylococcus aureus [TaxId: 426430]}
amkvavimgsssdwkimqescnmldyfeipyekqvvsahrtpkmmvqfasearerginii
iagaggaahlpgmvaslttlpvigvpietkslkgidsllsivqmpggipvattaigaaga
knagilaarmlsiqnpslveklnqyessliqkvedmqnelq

SCOPe Domain Coordinates for d3orsf_:

Click to download the PDB-style file with coordinates for d3orsf_.
(The format of our PDB-style files is described here.)

Timeline for d3orsf_: