SCOP 1.67: Domain d1fl3a2: 1fl3 A:117-214

Lineage for d1fl3a2 (1fl3 A:117-214)

Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
Domain d1fl3a2: 1fl3 A:117-214 [21450]
Other proteins in same PDB: d1fl3a1, d1fl3b1, d1fl3b2, d1fl3h1, d1fl3l1, d1fl3l2
part of blue fluorescent Fab 19G2
complexed with spb

Details for d1fl3a2

PDB Entry: 1fl3 (more details), 2.45 Å

PDB Description: crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k

SCOP Domain Sequences for d1fl3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl3a2 b.1.1.2 (A:117-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvypaapgcgdttgssvtlgclvkgyfpepvtvtwnsggssvhtfpallqsgly
tmsssvtvpsstwpstvtcsvahpassttvdkkle

SCOP Domain Coordinates for d1fl3a2:

Click to download the PDB-style file with coordinates for d1fl3a2.
(The format of our PDB-style files is described here.)

Timeline for d1fl3a2: