SCOP 1.63: Domain d1fl3a2: 1fl3 A:117-214

Lineage for d1fl3a2 (1fl3 A:117-214)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Blue fluorescent Fab 19G2, (mouse), kappa L chain [49110] (1 PDB entry)

8. Domain d1fl3a2: 1fl3 A:117-214 [21450]
   Other proteins in same PDB: d1fl3a1, d1fl3b1, d1fl3h1, d1fl3l1

Details for d1fl3a2

PDB Entry: 1fl3, 2.45 Å

PDB Description: crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k

SCOP Domain Sequences for d1fl3a2:

Sequence; same for both SEQRES and ATOM records:

>d1fl3a2 b.1.1.2 (A:117-214) Immunoglobulin (constant domains of L and H chains) {Blue fluorescent Fab 19G2, (mouse), kappa L chain}
akttppsvypaapgcgdttgssvtlgclvkgyfpepvtvtwnsggssvhtfpallqsgly
tmsssvtvpsstwpstvtcsvahpassttvdkkle

Timeline for d1fl3a2:

• d1fl3a2 first appeared (with stable ids) in SCOP 1.55
  
• d1fl3a2 appears in SCOP 1.61
  
• d1fl3a2 appears in SCOP 1.65
  
• d1fl3a2 appears in the current release, SCOPe 2.08