| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) ![]() |
| Family c.23.8.0: automated matches [191522] (1 protein) not a true family |
| Protein automated matches [190879] (8 species) not a true protein |
| Species Staphylococcus aureus [TaxId:426430] [226174] (1 PDB entry) |
| Domain d3orse1: 3ors E:1-159 [214499] Other proteins in same PDB: d3orsa2, d3orsb2, d3orsc2, d3orsd2, d3orse2, d3orsf2, d3orsg2, d3orsh2 automated match to d3lp6b_ complexed with so4 |
PDB Entry: 3ors (more details), 1.45 Å
SCOPe Domain Sequences for d3orse1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3orse1 c.23.8.0 (E:1-159) automated matches {Staphylococcus aureus [TaxId: 426430]}
mkvavimgsssdwkimqescnmldyfeipyekqvvsahrtpkmmvqfasearerginiii
agaggaahlpgmvaslttlpvigvpietkslkgidsllsivqmpggipvattaigaagak
nagilaarmlsiqnpslveklnqyessliqkvedmqnel
Timeline for d3orse1: