Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (17 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:419947] [226040] (7 PDB entries) |
Domain d3orpa_: 3orp A: [214494] automated match to d1mrub_ complexed with ags; mutant |
PDB Entry: 3orp (more details), 2.1 Å
SCOPe Domain Sequences for d3orpa_:
Sequence, based on SEQRES records: (download)
>d3orpa_ d.144.1.7 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} mttpshlsdryelgeilgfggmsevhlardlrdhrdvavkvlradlardpsfylrfrrea qnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraievia dacqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigta qylspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarh eglsadldavvlkalaknpenryqtaaemradlvrvhngeppeapkvltd
>d3orpa_ d.144.1.7 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} mttpshlsdryelgeilgfggmsevhlardlrdhrdvavkvlradlardpsfylrfrrea qnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraievia dacqalnfshqngiihrdvkpanimisatnavkvmdfgiaigtaqylspeqargdsvdar sdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkala knpenryqtaaemradlvrvhngeppeapkvltd
Timeline for d3orpa_: