Lineage for d3orma_ (3orm A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (19 species)
    not a true protein
  7. 2546151Species Mycobacterium tuberculosis [TaxId:419947] [226040] (7 PDB entries)
  8. 2546160Domain d3orma_: 3orm A: [214492]
    automated match to d1mrub_
    complexed with ags, mn; mutant

Details for d3orma_

PDB Entry: 3orm (more details), 2.5 Å

PDB Description: Mycobacterium tuberculosis PknB kinase domain D76A mutant
PDB Compounds: (A:) Serine/threonine protein kinase

SCOPe Domain Sequences for d3orma_:

Sequence, based on SEQRES records: (download)

>d3orma_ d.144.1.7 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
ryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqnaaalnhp
aivavyatgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviadacqalnfs
hqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigtaqylspeqar
gdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadlda
vvlkalaknpenryqtaaemradlvrvhngeppeapkvlt

Sequence, based on observed residues (ATOM records): (download)

>d3orma_ d.144.1.7 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
ryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqnaaalnhp
aivavyatgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviadacqalnfs
hqngiihrdvkpanimisatnavkvmdfgiaraiataqylspeqargdsvdarsdvyslg
cvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalaknpenry
qtaaemradlvrvhngeppeapkvlt

SCOPe Domain Coordinates for d3orma_:

Click to download the PDB-style file with coordinates for d3orma_.
(The format of our PDB-style files is described here.)

Timeline for d3orma_: