Lineage for d3ordb_ (3ord B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299472Protein Dehaloperoxidase [46530] (1 species)
  7. 2299473Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries)
  8. 2299533Domain d3ordb_: 3ord B: [214481]
    automated match to d1ew6a_
    complexed with hem, so4, xe

Details for d3ordb_

PDB Entry: 3ord (more details), 2.22 Å

PDB Description: Structural Evidence for Stabilization of Inhibitor Binding by a Protein Cavity in the Dehaloperoxidase-Hemoglobin from Amphitrite ornata
PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d3ordb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ordb_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d3ordb_:

Click to download the PDB-style file with coordinates for d3ordb_.
(The format of our PDB-style files is described here.)

Timeline for d3ordb_: