SCOP 1.71: Domain d1fl3h2: 1fl3 H:117-214

Lineage for d1fl3h2 (1fl3 H:117-214)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1fl3h2: 1fl3 H:117-214 [21448]
   Other proteins in same PDB: d1fl3a1, d1fl3b1, d1fl3b2, d1fl3h1, d1fl3l1, d1fl3l2

Details for d1fl3h2

PDB Entry: 1fl3, 2.45 Å

PDB Description: crystal structure of the blue fluorescent antibody (19g2) in complex with stilbene hapten at 277k

SCOP Domain Sequences for d1fl3h2:

Sequence; same for both SEQRES and ATOM records:

>d1fl3h2 b.1.1.2 (H:117-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvypaapgcgdttgssvtlgclvkgyfpepvtvtwnsggssvhtfpallqsgly
tmsssvtvpsstwpstvtcsvahpassttvdkkle

Timeline for d1fl3h2:

• d1fl3h2 first appeared (with stable ids) in SCOP 1.55
  
• d1fl3h2 appears in SCOP 1.69
  
• d1fl3h2 appears in SCOP 1.73
  
• d1fl3h2 appears in the current release, SCOPe 2.08