Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Blue fluorescent Fab 19G2, (mouse), kappa L chain [49110] (1 PDB entry) |
Domain d1fl3h2: 1fl3 H:117-214 [21448] Other proteins in same PDB: d1fl3a1, d1fl3b1, d1fl3h1, d1fl3l1 |
PDB Entry: 1fl3 (more details), 2.45 Å
SCOP Domain Sequences for d1fl3h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fl3h2 b.1.1.2 (H:117-214) Immunoglobulin (constant domains of L and H chains) {Blue fluorescent Fab 19G2, (mouse), kappa L chain} akttppsvypaapgcgdttgssvtlgclvkgyfpepvtvtwnsggssvhtfpallqsgly tmsssvtvpsstwpstvtcsvahpassttvdkkle
Timeline for d1fl3h2: