SCOPe 2.08: Domain d3oqpb_: 3oqp B:

Lineage for d3oqpb_ (3oqp B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (26 species)
   not a true protein

7. Species Burkholderia xenovorans [TaxId:266265] [225992] (1 PDB entry)

8. Domain d3oqpb_: 3oqp B: [214479]
   automated match to d3lqya_
   complexed with cl, pg4

Details for d3oqpb_

PDB Entry: 3oqp, 1.22 Å

PDB Description: crystal structure of a putative isochorismatase (bxe_a0706) from burkholderia xenovorans lb400 at 1.22 a resolution

PDB Compounds: (B:) Putative isochorismatase

SCOPe Domain Sequences for d3oqpb_:

Sequence; same for both SEQRES and ATOM records:

>d3oqpb_ c.33.1.0 (B:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ttprralividvqneyvtgdlpieypdvqsslaniaramdaaraagvpvvivqnfapags
plfargsngaelhpvvserardhyvekslpsaftgtdlagwlaarqidtltvtgymthnc
dastinhavhsglaveflhdatgsvpyensagfasaeeihrvfsvvlqsrfaavastdew
iaavqggtplargniyasnqkararrat

Timeline for d3oqpb_:

• d3oqpb_ first appeared in SCOPe 2.03
  
• d3oqpb_ appears in SCOPe 2.07