Lineage for d3oqpb_ (3oqp B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864227Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2864228Protein automated matches [190499] (26 species)
    not a true protein
  7. 2864266Species Burkholderia xenovorans [TaxId:266265] [225992] (1 PDB entry)
  8. 2864268Domain d3oqpb_: 3oqp B: [214479]
    automated match to d3lqya_
    complexed with cl, pg4

Details for d3oqpb_

PDB Entry: 3oqp (more details), 1.22 Å

PDB Description: crystal structure of a putative isochorismatase (bxe_a0706) from burkholderia xenovorans lb400 at 1.22 a resolution
PDB Compounds: (B:) Putative isochorismatase

SCOPe Domain Sequences for d3oqpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oqpb_ c.33.1.0 (B:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
ttprralividvqneyvtgdlpieypdvqsslaniaramdaaraagvpvvivqnfapags
plfargsngaelhpvvserardhyvekslpsaftgtdlagwlaarqidtltvtgymthnc
dastinhavhsglaveflhdatgsvpyensagfasaeeihrvfsvvlqsrfaavastdew
iaavqggtplargniyasnqkararrat

SCOPe Domain Coordinates for d3oqpb_:

Click to download the PDB-style file with coordinates for d3oqpb_.
(The format of our PDB-style files is described here.)

Timeline for d3oqpb_: