SCOP 1.55: Domain d1emth2: 1emt H:117-216

Lineage for d1emth2 (1emt H:117-216)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Anti-C60 fullerene Fab, (mouse), kappa L chain [49109] (1 PDB entry)

8. Domain d1emth2: 1emt H:117-216 [21447]
   Other proteins in same PDB: d1emth1, d1emtl1

Details for d1emth2

PDB Entry: 1emt, 2.25 Å

PDB Description: fab antibody fragment of an c60 antifullerene antibody

SCOP Domain Sequences for d1emth2:

Sequence, based on SEQRES records:

>d1emth2 b.1.1.2 (H:117-216) Immunoglobulin (constant domains of L and H chains) {Anti-C60 fullerene Fab, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records):

>d1emth2 b.1.1.2 (H:117-216) Immunoglobulin (constant domains of L and H chains) {Anti-C60 fullerene Fab, (mouse), kappa L chain}
akttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpssprpsetvtcnvahpasstkvdkkivpr

Timeline for d1emth2:

• d1emth2 appears in SCOP 1.57
  
• d1emth2 appears in the current release, SCOPe 2.08