Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Anti-C60 fullerene Fab, (mouse), kappa L chain [49109] (1 PDB entry) |
Domain d1emth2: 1emt H:117-216 [21447] Other proteins in same PDB: d1emth1, d1emtl1 |
PDB Entry: 1emt (more details), 2.25 Å
SCOP Domain Sequences for d1emth2:
Sequence, based on SEQRES records: (download)
>d1emth2 b.1.1.2 (H:117-216) Immunoglobulin (constant domains of L and H chains) {Anti-C60 fullerene Fab, (mouse), kappa L chain} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
>d1emth2 b.1.1.2 (H:117-216) Immunoglobulin (constant domains of L and H chains) {Anti-C60 fullerene Fab, (mouse), kappa L chain} akttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls ssvtvpssprpsetvtcnvahpasstkvdkkivpr
Timeline for d1emth2: