SCOPe 2.05: Domain d3op1b2: 3op1 B:186-305

Lineage for d3op1b2 (3op1 B:186-305)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families)

5. Family b.43.5.0: automated matches [227257] (1 protein)
   not a true family

6. Protein automated matches [227042] (2 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [225991] (1 PDB entry)

8. Domain d3op1b2: 3op1 B:186-305 [214456]
   Other proteins in same PDB: d3op1a1, d3op1b1, d3op1c1
   automated match to d1mrza1
   complexed with acy, cl, gol, peg, so4

Details for d3op1b2

PDB Entry: 3op1, 2.49 Å

PDB Description: Crystal Structure of Macrolide-efflux Protein SP_1110 from Streptococcus pneumoniae

PDB Compounds: (B:) Macrolide-efflux protein

SCOPe Domain Sequences for d3op1b2:

Sequence; same for both SEQRES and ATOM records:

>d3op1b2 b.43.5.0 (B:186-305) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
plpsrgmvvhgnargrtigyptanlvlldrtympadgvyvvdveiqrqkyramasvgknv
tfdgeearfevnifdfnqdiygetvmvywldrirdmtkfdsvdqlvdqlkadeevtrnws

Timeline for d3op1b2:

• d3op1b2 first appeared in SCOPe 2.03
  
• d3op1b2 appears in SCOPe 2.04
  
• d3op1b2 appears in SCOPe 2.06
  
• d3op1b2 appears in the current release, SCOPe 2.08