SCOPe 2.08: Domain d3ooma_: 3oom A:

Lineage for d3ooma_ (3oom A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d3ooma_: 3oom A: [214451]
   automated match to d3tzma_
   complexed with 507, edo, po4

Details for d3ooma_

PDB Entry: 3oom, 2 Å

PDB Description: crystal structure of the acvr1 kinase domain in complex with the imidazo[1,2-b]pyridazine inhibitor k00507

PDB Compounds: (A:) Activin receptor type-1

SCOPe Domain Sequences for d3ooma_:

Sequence; same for both SEQRES and ATOM records:

>d3ooma_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrheni
lgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhie
ifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkrym
apevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsfe
dmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltkid

Timeline for d3ooma_:

• d3ooma_ first appeared in SCOPe 2.03
  
• d3ooma_ appears in SCOPe 2.07