SCOP 1.63: Domain d1etzb2: 1etz B:127-228

Lineage for d1etzb2 (1etz B:127-228)

Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
Species Anti-sweetener Fab NC10.14, (mouse), lamba L chain [49108] (1 PDB entry)
Domain d1etzb2: 1etz B:127-228 [21445]
Other proteins in same PDB: d1etza1, d1etzb1, d1etzh1, d1etzl1
complexed with gas

Details for d1etzb2

PDB Entry: 1etz (more details), 2.6 Å

PDB Description: the three-dimensional structure of an anti-sweetener fab, nc10.14, shows the extent of structural diversity in antigen recognition by immunoglobulins

SCOP Domain Sequences for d1etzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1etzb2 b.1.1.2 (B:127-228) Immunoglobulin (constant domains of L and H chains) {Anti-sweetener Fab NC10.14, (mouse), lamba L chain}
akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsg
lytmsssvtvpsstwpsqtvtcsvahpassttvdkklepsgp

SCOP Domain Coordinates for d1etzb2:

Click to download the PDB-style file with coordinates for d1etzb2.
(The format of our PDB-style files is described here.)

Timeline for d1etzb2: