SCOPe 2.08: Domain d3ooba2: 3oob A:51-163

Lineage for d3ooba2 (3oob A:51-163)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
   Domain 1 is a WW-domain

7. Species Human (Homo sapiens) [TaxId:9606] [54548] (52 PDB entries)

8. Domain d3ooba2: 3oob A:51-163 [214444]
   Other proteins in same PDB: d3ooba1
   automated match to d2itka2
   complexed with kdh, pe4, so4
   has additional insertions and/or extensions that are not grouped together

Details for d3ooba2

PDB Entry: 3oob, 1.89 Å

PDB Description: structural and functional insights of directly targeting pin1 by epigallocatechin-3-gallate

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d3ooba2:

Sequence; same for both SEQRES and ATOM records:

>d3ooba2 d.26.1.1 (A:51-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf
sdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

Timeline for d3ooba2:

• d3ooba2 first appeared in SCOPe 2.03
  
• d3ooba2 appears in SCOPe 2.07