SCOPe 2.05: Domain d3olha2: 3olh A:152-287

Lineage for d3olha2 (3olh A:152-287)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.0: automated matches [227256] (1 protein)
   not a true family

6. Protein automated matches [227041] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225989] (3 PDB entries)

8. Domain d3olha2: 3olh A:152-287 [214435]
   automated match to d1rhda2
   complexed with na, so4

Details for d3olha2

PDB Entry: 3olh, 2.5 Å

PDB Description: human 3-mercaptopyruvate sulfurtransferase

PDB Compounds: (A:) 3-mercaptopyruvate sulfurtransferase

SCOPe Domain Sequences for d3olha2:

Sequence; same for both SEQRES and ATOM records:

>d3olha2 c.46.1.0 (A:152-287) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aefraqldpafiktyedikenlesrrfqvvdsratgrfrgtepeprdgiepghipgtvni
pftdflsqeglekspeeirhlfqekkvdlskplvatcgsgvtachvalgaylcgkpdvpi
ydgswvewymrarped

Timeline for d3olha2:

• d3olha2 first appeared in SCOPe 2.03
  
• d3olha2 appears in SCOPe 2.04
  
• d3olha2 appears in SCOPe 2.06
  
• d3olha2 appears in the current release, SCOPe 2.08