Lineage for d3olha2 (3olh A:152-287)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876007Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2876008Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 2876105Family c.46.1.0: automated matches [227256] (1 protein)
    not a true family
  6. 2876106Protein automated matches [227041] (2 species)
    not a true protein
  7. 2876107Species Human (Homo sapiens) [TaxId:9606] [225989] (3 PDB entries)
  8. 2876115Domain d3olha2: 3olh A:152-287 [214435]
    Other proteins in same PDB: d3olha3
    automated match to d1rhda2
    complexed with na, so4

Details for d3olha2

PDB Entry: 3olh (more details), 2.5 Å

PDB Description: human 3-mercaptopyruvate sulfurtransferase
PDB Compounds: (A:) 3-mercaptopyruvate sulfurtransferase

SCOPe Domain Sequences for d3olha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3olha2 c.46.1.0 (A:152-287) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aefraqldpafiktyedikenlesrrfqvvdsratgrfrgtepeprdgiepghipgtvni
pftdflsqeglekspeeirhlfqekkvdlskplvatcgsgvtachvalgaylcgkpdvpi
ydgswvewymrarped

SCOPe Domain Coordinates for d3olha2:

Click to download the PDB-style file with coordinates for d3olha2.
(The format of our PDB-style files is described here.)

Timeline for d3olha2: