Lineage for d3olda2 (3old A:404-496)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400341Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 protein domains)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2400370Protein Animal alpha-amylase [51024] (3 species)
  7. 2400371Species Human (Homo sapiens) [TaxId:9606] [51026] (53 PDB entries)
    Uniprot P04746 16-511 ! SQ 04746
  8. 2400418Domain d3olda2: 3old A:404-496 [214429]
    Other proteins in same PDB: d3olda1
    automated match to d1jfha1
    complexed with aci, bgc, ca, cl, g6d, glc, mpd, nag, pca, so4

Details for d3olda2

PDB Entry: 3old (more details), 2 Å

PDB Description: crystal structure of alpha-amylase in complex with acarviostatin i03
PDB Compounds: (A:) Pancreatic alpha-amylase

SCOPe Domain Sequences for d3olda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3olda2 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d3olda2:

Click to download the PDB-style file with coordinates for d3olda2.
(The format of our PDB-style files is described here.)

Timeline for d3olda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3olda1