Lineage for d3ol2a3 (3ol2 A:561-648)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031531Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2031865Protein Semaphorin 4d Ig-like domain [101515] (1 species)
  7. 2031866Species Human (Homo sapiens) [TaxId:9606] [101516] (2 PDB entries)
  8. 2031869Domain d3ol2a3: 3ol2 A:561-648 [214427]
    Other proteins in same PDB: d3ol2a1, d3ol2a2
    automated match to d1olza1
    complexed with nag

Details for d3ol2a3

PDB Entry: 3ol2 (more details), 2.99 Å

PDB Description: receptor-ligand structure of human semaphorin 4d with plexin b1.
PDB Compounds: (A:) Semaphorin-4D

SCOPe Domain Sequences for d3ol2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ol2a3 b.1.1.4 (A:561-648) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]}
yrqhffkhggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlsegdsg
vyqclseervknktvfqvvakhvlevkv

SCOPe Domain Coordinates for d3ol2a3:

Click to download the PDB-style file with coordinates for d3ol2a3.
(The format of our PDB-style files is described here.)

Timeline for d3ol2a3: