| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Semaphorin 4d Ig-like domain [101515] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101516] (2 PDB entries) |
| Domain d3ol2a3: 3ol2 A:561-648 [214427] Other proteins in same PDB: d3ol2a1, d3ol2a2 automated match to d1olza1 complexed with nag |
PDB Entry: 3ol2 (more details), 2.99 Å
SCOPe Domain Sequences for d3ol2a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ol2a3 b.1.1.4 (A:561-648) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]}
yrqhffkhggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlsegdsg
vyqclseervknktvfqvvakhvlevkv
Timeline for d3ol2a3: