Class g: Small proteins [56992] (98 folds) |
Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies) disulfide-rich fold; common core is alpha+beta with two conserved disulfides |
Superfamily g.16.2: Plexin repeat [103575] (1 family) |
Family g.16.2.1: Plexin repeat [103576] (3 proteins) Pfam PF01437 |
Protein Semaphorin 4d [103577] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [103578] (2 PDB entries) |
Domain d3ol2a2: 3ol2 A:502-555 [214426] Other proteins in same PDB: d3ol2a1, d3ol2a3 automated match to d1olza3 complexed with nag |
PDB Entry: 3ol2 (more details), 2.99 Å
SCOPe Domain Sequences for d3ol2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ol2a2 g.16.2.1 (A:502-555) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]} fcgkhgtcedcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpd
Timeline for d3ol2a2: