Lineage for d3ol2a2 (3ol2 A:502-555)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260335Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 2260364Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 2260365Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam PF01437
  6. 2260380Protein Semaphorin 4d [103577] (1 species)
  7. 2260381Species Human (Homo sapiens) [TaxId:9606] [103578] (2 PDB entries)
  8. 2260384Domain d3ol2a2: 3ol2 A:502-555 [214426]
    Other proteins in same PDB: d3ol2a1, d3ol2a3
    automated match to d1olza3
    complexed with nag

Details for d3ol2a2

PDB Entry: 3ol2 (more details), 2.99 Å

PDB Description: receptor-ligand structure of human semaphorin 4d with plexin b1.
PDB Compounds: (A:) Semaphorin-4D

SCOPe Domain Sequences for d3ol2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ol2a2 g.16.2.1 (A:502-555) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]}
fcgkhgtcedcvlardpycawspptatcvalhqtespsrgliqemsgdasvcpd

SCOPe Domain Coordinates for d3ol2a2:

Click to download the PDB-style file with coordinates for d3ol2a2.
(The format of our PDB-style files is described here.)

Timeline for d3ol2a2: