Lineage for d3ol2a1 (3ol2 A:24-501)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066460Superfamily b.69.12: Sema domain [101912] (1 family) (S)
    irregular 7-bladed beta-propeller with a large insertion in the fifth blade
    automatically mapped to Pfam PF01403
  5. 2066461Family b.69.12.1: Sema domain [101913] (3 protein domains)
    Pfam PF01403
  6. 2066469Protein Semaphorin 4d [101914] (1 species)
  7. 2066470Species Human (Homo sapiens) [TaxId:9606] [101915] (2 PDB entries)
  8. 2066473Domain d3ol2a1: 3ol2 A:24-501 [214425]
    Other proteins in same PDB: d3ol2a2, d3ol2a3
    automated match to d1olza2
    complexed with nag

Details for d3ol2a1

PDB Entry: 3ol2 (more details), 2.99 Å

PDB Description: Receptor-ligand structure of Human Semaphorin 4D with Plexin B1.
PDB Compounds: (A:) Semaphorin-4D

SCOPe Domain Sequences for d3ol2a1:

Sequence, based on SEQRES records: (download)

>d3ol2a1 b.69.12.1 (A:24-501) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]}
fapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisekqh
evywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnltsf
kflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrteyai
pwlnepsfvfadvirkspdspdgeddrvyffftevsveyefvfrvlipriarvckgdqgg
lrtlqkkwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvgls
avcaynlstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanytss
lnlpdktlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfvst
drgalhkaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqapla

Sequence, based on observed residues (ATOM records): (download)

>d3ol2a1 b.69.12.1 (A:24-501) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]}
fapipritwehrevhlvqfhepdiynysalllsedkdtlyigareavfavnalnisekqh
evywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhlnltsf
kflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrteyai
pwlnepsfvfadvirkgeddrvyffftevsveyefvfrvlipriarvckgdqgglrtlqk
kwtsflkarlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvglsavcayn
lstaeevfshgkymqsttveqshtkwvryngpvpkprpgacidsearaanytsslnlpdk
tlqfvkdhplmddsvtpidnrprlikkdvnytqivvdrtqaldgtvydvmfvstdrgalh
kaislehavhiieetqlfqdfepvqtlllsskkgnrfvyagsnsgvvqapla

SCOPe Domain Coordinates for d3ol2a1:

Click to download the PDB-style file with coordinates for d3ol2a1.
(The format of our PDB-style files is described here.)

Timeline for d3ol2a1: