Lineage for d3oksd1 (3oks D:1-446)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132688Species Mycobacterium smegmatis [TaxId:246196] [226015] (2 PDB entries)
  8. 2132692Domain d3oksd1: 3oks D:1-446 [214424]
    Other proteins in same PDB: d3oksb2, d3oksc2, d3oksd2
    automated match to d1ohwa_
    complexed with edo, fmt, mg

Details for d3oksd1

PDB Entry: 3oks (more details), 1.8 Å

PDB Description: crystal structure of 4-aminobutyrate transaminase from mycobacterium smegmatis
PDB Compounds: (D:) 4-aminobutyrate transaminase

SCOPe Domain Sequences for d3oksd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oksd1 c.67.1.0 (D:1-446) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mvshpeqsrhlataipgprsqalidrkgtavargvgttmpvyavragggivedvdgnrli
dlgsgiavttvgnsapkvveavrsqvgdfthtcfmvtpyegyvavceqlnrltpvrgdkr
salfnsgseavenavkiarshthkpavvafdhayhgrtnltmaltakvmpykdgfgpfap
eiyraplsypfrdaefgkelatdgelaakraitvidkqigadnlaavviepiqgeggfiv
padgflptlldwcrkndvvfiadevqtgfartgamfacehegidpdlivtakgiagglpl
savtgraeimdsphvsglggtyggnpiacaaalatietieseglvaraqqiekimkdrlg
rlqaeddrigdvrgrgamiamelvkagttepdadltkalcagahaagvivlscgtygnvv
rflpplsigddllnegldvleevlrg

SCOPe Domain Coordinates for d3oksd1:

Click to download the PDB-style file with coordinates for d3oksd1.
(The format of our PDB-style files is described here.)

Timeline for d3oksd1: