![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:246196] [226015] (2 PDB entries) |
![]() | Domain d3oksb1: 3oks B:3-446 [214422] Other proteins in same PDB: d3oksb2, d3oksc2, d3oksd2 automated match to d1ohwa_ complexed with edo, fmt, mg |
PDB Entry: 3oks (more details), 1.8 Å
SCOPe Domain Sequences for d3oksb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oksb1 c.67.1.0 (B:3-446) automated matches {Mycobacterium smegmatis [TaxId: 246196]} shpeqsrhlataipgprsqalidrkgtavargvgttmpvyavragggivedvdgnrlidl gsgiavttvgnsapkvveavrsqvgdfthtcfmvtpyegyvavceqlnrltpvrgdkrsa lfnsgseavenavkiarshthkpavvafdhayhgrtnltmaltakvmpykdgfgpfapei yraplsypfrdaefgkelatdgelaakraitvidkqigadnlaavviepiqgeggfivpa dgflptlldwcrkndvvfiadevqtgfartgamfacehegidpdlivtakgiagglplsa vtgraeimdsphvsglggtyggnpiacaaalatietieseglvaraqqiekimkdrlgrl qaeddrigdvrgrgamiamelvkagttepdadltkalcagahaagvivlscgtygnvvrf lpplsigddllnegldvleevlrg
Timeline for d3oksb1: