Lineage for d3oksb1 (3oks B:3-446)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897494Species Mycobacterium smegmatis [TaxId:246196] [226015] (2 PDB entries)
  8. 2897496Domain d3oksb1: 3oks B:3-446 [214422]
    Other proteins in same PDB: d3oksb2, d3oksc2, d3oksd2
    automated match to d1ohwa_
    complexed with edo, fmt, mg

Details for d3oksb1

PDB Entry: 3oks (more details), 1.8 Å

PDB Description: crystal structure of 4-aminobutyrate transaminase from mycobacterium smegmatis
PDB Compounds: (B:) 4-aminobutyrate transaminase

SCOPe Domain Sequences for d3oksb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oksb1 c.67.1.0 (B:3-446) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
shpeqsrhlataipgprsqalidrkgtavargvgttmpvyavragggivedvdgnrlidl
gsgiavttvgnsapkvveavrsqvgdfthtcfmvtpyegyvavceqlnrltpvrgdkrsa
lfnsgseavenavkiarshthkpavvafdhayhgrtnltmaltakvmpykdgfgpfapei
yraplsypfrdaefgkelatdgelaakraitvidkqigadnlaavviepiqgeggfivpa
dgflptlldwcrkndvvfiadevqtgfartgamfacehegidpdlivtakgiagglplsa
vtgraeimdsphvsglggtyggnpiacaaalatietieseglvaraqqiekimkdrlgrl
qaeddrigdvrgrgamiamelvkagttepdadltkalcagahaagvivlscgtygnvvrf
lpplsigddllnegldvleevlrg

SCOPe Domain Coordinates for d3oksb1:

Click to download the PDB-style file with coordinates for d3oksb1.
(The format of our PDB-style files is described here.)

Timeline for d3oksb1: