SCOPe 2.08: Domain d3oksb1: 3oks B:3-446

Lineage for d3oksb1 (3oks B:3-446)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [226015] (2 PDB entries)

8. Domain d3oksb1: 3oks B:3-446 [214422]
   Other proteins in same PDB: d3oksb2, d3oksc2, d3oksd2
   automated match to d1ohwa_
   complexed with edo, fmt, mg

Details for d3oksb1

PDB Entry: 3oks, 1.8 Å

PDB Description: crystal structure of 4-aminobutyrate transaminase from mycobacterium smegmatis

PDB Compounds: (B:) 4-aminobutyrate transaminase

SCOPe Domain Sequences for d3oksb1:

Sequence; same for both SEQRES and ATOM records:

>d3oksb1 c.67.1.0 (B:3-446) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
shpeqsrhlataipgprsqalidrkgtavargvgttmpvyavragggivedvdgnrlidl
gsgiavttvgnsapkvveavrsqvgdfthtcfmvtpyegyvavceqlnrltpvrgdkrsa
lfnsgseavenavkiarshthkpavvafdhayhgrtnltmaltakvmpykdgfgpfapei
yraplsypfrdaefgkelatdgelaakraitvidkqigadnlaavviepiqgeggfivpa
dgflptlldwcrkndvvfiadevqtgfartgamfacehegidpdlivtakgiagglplsa
vtgraeimdsphvsglggtyggnpiacaaalatietieseglvaraqqiekimkdrlgrl
qaeddrigdvrgrgamiamelvkagttepdadltkalcagahaagvivlscgtygnvvrf
lpplsigddllnegldvleevlrg

Timeline for d3oksb1:

• d3oksb1 first appeared in SCOPe 2.03, called d3oksb_
  
• d3oksb1 appears in SCOPe 2.07