Lineage for d3okna1 (3okn A:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759931Domain d3okna1: 3okn A:1-107 [214417]
    Other proteins in same PDB: d3okna2, d3oknb_
    automated match to d1eapa1
    complexed with zn

Details for d3okna1

PDB Entry: 3okn (more details), 2.15 Å

PDB Description: crystal structure of s25-39 in complex with kdo(2.4)kdo(2.4)kdo
PDB Compounds: (A:) S25-39 Fab (IgG1k) light chain

SCOPe Domain Sequences for d3okna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3okna1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspsslavsagekvtmnckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdfaltissvqaedlavyyckqsynlrtfgggtkleik

SCOPe Domain Coordinates for d3okna1:

Click to download the PDB-style file with coordinates for d3okna1.
(The format of our PDB-style files is described here.)

Timeline for d3okna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3okna2
View in 3D
Domains from other chains:
(mouse over for more information)
d3oknb_