SCOPe 2.08: Domain d3okma2: 3okm A:108-214

Lineage for d3okma2 (3okm A:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3okma2: 3okm A:108-214 [214416]
   Other proteins in same PDB: d3okma1, d3okmb_
   automated match to d1eapa2

Details for d3okma2

PDB Entry: 3okm, 2.4 Å

PDB Description: crystal structure of unliganded s25-39

PDB Compounds: (A:) S25-39 Fab (IgG1k) light chain

SCOPe Domain Sequences for d3okma2:

Sequence, based on SEQRES records:

>d3okma2 b.1.1.2 (A:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserangvlnswtdqd
skdstysmtstltltkdeyerhnsytceashktstspivksfnrnec

Sequence, based on observed residues (ATOM records):

>d3okma2 b.1.1.2 (A:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgngvlnswtdqdskds
tysmtstltltkdeyerhnsytceashktstspivksfnrnec

Timeline for d3okma2:

• d3okma2 first appeared in SCOPe 2.03
  
• d3okma2 appears in SCOPe 2.07