Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains) [49107] (2 PDB entries) |
Domain d1c5bh2: 1c5b H:114-230 [21441] Other proteins in same PDB: d1c5bh1, d1c5bl1 |
PDB Entry: 1c5b (more details), 2.1 Å
SCOP Domain Sequences for d1c5bh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c5bh2 b.1.1.2 (H:114-230) Immunoglobulin (constant domains of L and H chains) {Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains)} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d1c5bh2: