SCOP 1.61: Domain d1c5bh2: 1c5b H:114-230

Lineage for d1c5bh2 (1c5b H:114-230)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains) [49107] (2 PDB entries)

8. Domain d1c5bh2: 1c5b H:114-230 [21441]
   Other proteins in same PDB: d1c5bh1, d1c5bl1

Details for d1c5bh2

PDB Entry: 1c5b, 2.1 Å

PDB Description: decarboxylase catalytic antibody 21d8 unliganded form

SCOP Domain Sequences for d1c5bh2:

Sequence; same for both SEQRES and ATOM records:

>d1c5bh2 b.1.1.2 (H:114-230) Immunoglobulin (constant domains of L and H chains) {Decarboxylase catalytic Fab 21D8, chimeric (mouse V domains/human C1 domains)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d1c5bh2:

• d1c5bh2 first appeared (with stable ids) in SCOP 1.55
  
• d1c5bh2 appears in SCOP 1.59
  
• d1c5bh2 appears in SCOP 1.63
  
• d1c5bh2 appears in the current release, SCOPe 2.08