Lineage for d3okda1 (3okd A:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1296867Domain d3okda1: 3okd A:1-107 [214407]
    Other proteins in same PDB: d3okda2
    automated match to d1eapa1
    complexed with kdo, peg, zn

Details for d3okda1

PDB Entry: 3okd (more details), 1.8 Å

PDB Description: crystal structure of s25-39 in complex with kdo
PDB Compounds: (A:) S25-39 Fab (IgG1k) light chain

SCOPe Domain Sequences for d3okda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3okda1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspsslavsagekvtmnckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdfaltissvqaedlavyyckqsynlrtfgggtkleik

SCOPe Domain Coordinates for d3okda1:

Click to download the PDB-style file with coordinates for d3okda1.
(The format of our PDB-style files is described here.)

Timeline for d3okda1: