Lineage for d3ok8b_ (3ok8 B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1509167Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 1509168Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 1509225Family a.238.1.0: automated matches [191660] (1 protein)
    not a true family
  6. 1509226Protein automated matches [191240] (2 species)
    not a true protein
  7. 1509235Species Mouse (Mus musculus) [TaxId:10090] [226171] (1 PDB entry)
  8. 1509237Domain d3ok8b_: 3ok8 B: [214406]
    automated match to d2ykta_
    complexed with gol

Details for d3ok8b_

PDB Entry: 3ok8 (more details), 2.25 Å

PDB Description: i-bar of pinkbar
PDB Compounds: (B:) Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2

SCOPe Domain Sequences for d3ok8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ok8b_ a.238.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
apemdqfyrstmaiyksimeqfnpalenlvylgnnylrafhalseaaevyfsaiqkigeq
alqsstsqilgeilvqmsdtqrhlnsdlevvvqtfhgdllqhmekntkldmqfikdscqh
yeieyrhraanlekcmselwrmerkrdknaremkesvnrlhaqmqafvseskraaeleek
rryrflaekhlllsntflqflgrargmlqnrvllwkeqs

SCOPe Domain Coordinates for d3ok8b_:

Click to download the PDB-style file with coordinates for d3ok8b_.
(The format of our PDB-style files is described here.)

Timeline for d3ok8b_: