SCOPe 2.06: Domain d3ok8a_: 3ok8 A:

Lineage for d3ok8a_ (3ok8 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.0: automated matches [191660] (1 protein)
   not a true family

6. Protein automated matches [191240] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226171] (1 PDB entry)

8. Domain d3ok8a_: 3ok8 A: [214405]
   automated match to d2ykta_
   complexed with gol

Details for d3ok8a_

PDB Entry: 3ok8, 2.25 Å

PDB Description: i-bar of pinkbar

PDB Compounds: (A:) Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2

SCOPe Domain Sequences for d3ok8a_:

Sequence; same for both SEQRES and ATOM records:

>d3ok8a_ a.238.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
apemdqfyrstmaiyksimeqfnpalenlvylgnnylrafhalseaaevyfsaiqkigeq
alqsstsqilgeilvqmsdtqrhlnsdlevvvqtfhgdllqhmekntkldmqfikdscqh
yeieyrhraanlekcmselwrmerkrdknaremkesvnrlhaqmqafvseskraaeleek
rryrflaekhlllsntflqflgrargmlqnrvllwkeqs

Timeline for d3ok8a_:

• d3ok8a_ first appeared in SCOPe 2.03
  
• d3ok8a_ appears in SCOPe 2.05
  
• d3ok8a_ appears in SCOPe 2.07
  
• d3ok8a_ appears in the current release, SCOPe 2.08