Class a: All alpha proteins [46456] (285 folds) |
Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
Family a.238.1.0: automated matches [191660] (1 protein) not a true family |
Protein automated matches [191240] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [226171] (1 PDB entry) |
Domain d3ok8a_: 3ok8 A: [214405] automated match to d2ykta_ complexed with gol |
PDB Entry: 3ok8 (more details), 2.25 Å
SCOPe Domain Sequences for d3ok8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ok8a_ a.238.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} apemdqfyrstmaiyksimeqfnpalenlvylgnnylrafhalseaaevyfsaiqkigeq alqsstsqilgeilvqmsdtqrhlnsdlevvvqtfhgdllqhmekntkldmqfikdscqh yeieyrhraanlekcmselwrmerkrdknaremkesvnrlhaqmqafvseskraaeleek rryrflaekhlllsntflqflgrargmlqnrvllwkeqs
Timeline for d3ok8a_: